Record in detail


General Info

  • lamp_id:L02A000281
  • Name:OPSV_XENLA
  • FullName:Violet-sensitive opsin
  • Source:Xenopus laevis
  • Mass:3878.7 Da
  • Sequence Length:34 aa
  • Isoelectric Point:11.01
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
  • Function:Visual pigments are the light-absorbing molecules that mediate vision. They consist of an apoprotein, opsin, covalently linked to cis-retinal.

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  281
  •   2  Database:DBAASP  1071
  •   3  Database:dbAMP  dbAMP_03588
  •   4  Database:SATPdb  satpdb28752
  •   5  Database:Uniprot  P51473
  •   6  Database:RAP  RAPD0105

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A002031    From 6 To 39 E-value: 0.0000000000004 Score: 65.1
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
  • 2. L02A000281    From 1 To 34 E-value: 0.0000000000006 Score: 64.7
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPEQ
  • 3. L01A003119    From 6 To 38 E-value: 0.000000000001 Score: 63.5
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
  • 4. L01A003120    From 1 To 33 E-value: 0.000000000002 Score: 62.8
        GLLRKGGEKIGEKLKKIGQKIKNFFQKLVPQPE
  • 5. L11A002032    From 6 To 39 E-value: 0.00000001 Score: 50.1
        GLVRKGGEKFGEKLRKIGQKIKEFFQKLALEIEQ

Structure

  •   Domains
  •   1  Name:7TM_GPCR_Rhodpsn    Interpro Link:IPR000276
  •   2  Name:GPCR_Rhodpsn_supfam    Interpro Link:IPR017452
  •   3  Name:Opsin    Interpro Link:IPR001760
  •   4  Name:Opsin_blue    Interpro Link:IPR001521
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Knox B.E.,Starace D.M.,
  •   Title:Cloning and expression of a Xenopus short wavelength cone pigment.
  •   Journal:Exp. Eye Res., 1998, 67, 209-220  [MEDLINE:98406020]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: