Record in detail


General Info

  • lamp_id:L02A000294
  • Name:ENA1_HORSE
  • FullName:Antimicrobial peptide eNAP-1
  • Source:Equus caballus
  • Mass:4668.2 Da
  • Sequence Length:44 aa
  • Isoelectric Point:6.18
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF
  • Function:Has antimicrobial activity against Gram-negative and Gram-positive bacteria.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000294    From 1 To 44 E-value: 4e-20 Score: 88.2
        DVQCGEGHFCHDQTCCRASQGGACCPYSQGVCCADQRHCCPVGF
  • 2. L01A000299    From 1 To 46 E-value: 3e-17 Score: 79
        DVQCGEGHFCHDXQTCCRASQGGXACCPYSQGVCCADQRHCCPVGF
  • 3. L03A000011    From 1 To 46 E-value: 2e-16 Score: 76.3
        DVQCGEGHFCHDXQTCCRASQGGXACCPYSQGVCCAVQRHCCPVGF
  • 4. L01A002645    From 29 To 57 E-value: 2.6 Score: 22.7
        EKELVRVRRGGYYCPFRQDKC---HRHCRSFG
  • 5. L01A003678    From 20 To 48 E-value: 3 Score: 22.3
        FCHDKNCPPPTSHVGSCHPEKRSCCKDRR

Structure

  •   Domains
  •   1  Name:Granulin    Interpro Link:IPR000118
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Lehrer R.I.,Hughes J.P.,Cullor J.S.,Harwig S.S.L.,Couto A.M.,
  •   Title:Identification of eNAP-1, an antimicrobial peptide from equine neutrophils.
  •   Journal:Infect. Immun., 1992, 60, 3065-3071  [MEDLINE:92347972]

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: