Record in detail


General Info

  • lamp_id:L02A000315
  • Name:Dermatoxin B1
  • FullName:Dermatoxin B1
  • Source:Phyllomedusa bicolor, South America
  • Mass:3250.7 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.51
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        SLGSFLKGVGTTLASVGKVVSDQFGKLLQAGQG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000081    From 45 To 77 E-value: 0.000000000001 Score: 63.5
        SLGSFLKGVGTTLASVGKVVSDQFGKLLQAGQG
  • 2. L02A000315    From 1 To 33 E-value: 0.000000000003 Score: 62
        SLGSFLKGVGTTLASVGKVVSDQFGKLLQAGQG
  • 3. L01A000150    From 1 To 32 E-value: 0.00000000001 Score: 60.5
        SLGSFLKGVGTTLASVGKVVSDQFGKLLQAGQ
  • 4. L03A000080    From 45 To 77 E-value: 0.000000001 Score: 53.5
        SLGSFMKGVGKGLATVGKIVADQFGKLLEAGKG
  • 5. L02A000907    From 1 To 33 E-value: 0.000000001 Score: 53.1
        SLGSFMKGVGKGLATVGKIVADQFGKLLEAGQG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: