Record in detail


General Info

  • lamp_id:L02A000370
  • Name:PMP36_PIG
  • FullName:Antibacterial peptide PMAP-36
  • Source:Sus scrofa
  • Mass:4256.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:12.82
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
  • Function:Exerts antimicrobial activity against both Gram-positive and negative bacteria. Its activity appears to be mediated by its ability to damage bacterial membranes.

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000370    From 1 To 37 E-value: 0.000000000000009 Score: 70.5
        VGRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
  • 2. L01A000219    From 1 To 36 E-value: 0.00000000000003 Score: 68.9
        GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGCG
  • 3. L13A024076    From 1 To 35 E-value: 0.000001 Score: 43.5
        GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLGC
  • 4. L13A023512    From 1 To 34 E-value: 0.00001 Score: 40
        GRFRRLRKKTRKRLKKIGKVLKWIPPIVGSIPLG
  • 5. L11A010644    From 1 To 24 E-value: 0.0001 Score: 37.4
        GVFRRLRKVTRKVLKKIGKVLKWI

Structure

  •   Domains
  •   1  Name:Cathelicidin    Interpro Link:IPR001894
  •   2  Name:Cathelicidin_CS    Interpro Link:IPR018216
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference
  •   [1]  Zanetti M.,Gennaro R.,Tossi A.,Scocchi M.,Storici P.,
  •   Title:Chemical synthesis and biological activity of a novel antibacterial peptide deduced from a pig myeloid cDNA.
  •   Journal:FEBS Lett., 1994, 337, 303-307  [MEDLINE:94123775]

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: