Record in detail
General Info
- lamp_id:L02A000400
- Name:SPYY_PHYBI
- FullName:Skin peptide tyrosine-tyrosine
- Source:Phyllomedusa bicolor
- Mass:4264.7 Da
- Sequence Length:36 aa
- Isoelectric Point:7.53
- Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
- Sequence
YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY - Function:Shows a broad spectrum of antibacterial activity against Gram-positive and Gram-negative bacteria, yeast and fungi.
Cross-Linking
- Cross-linking
- 1 Database:APD 400
- 2 Database:CAMP CAMPSQ2770
- 3 Database:DBAASP 816
- 4 Database:dbAMP dbAMP_12244
- 5 Database:DRAMP DRAMP01627
- 6 Database:SATPdb satpdb19995
- 7 Database:Uniprot P80952
- 8 Database:AMD SPYY_PHYBI
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L02A000400 From 1 To 36 E-value: 2e-16 Score: 76.3
YPPKPESPGEDASPEEMNKYLTALRHYINLVTRQRY - 2. L11A004190 From 1 To 36 E-value: 0.00000000001 Score: 60.5
YPIKPEAPREDASPEELNRYYASLRHYLNLVTRQRY - 3. L02A001474 From 1 To 36 E-value: 0.00000000007 Score: 57.8
YPSKPDNPGEDAPAEDMARYYSALRHYINLITRQRY - 4. L13A020613 From 1 To 36 E-value: 0.0000000002 Score: 56.6
YPSKPDNPGEDAPAEDLARYYSALRHYINLITRQRY - 5. L01A000303 From 1 To 23 E-value: 0.00000001 Score: 50.4
PEEMNKYLTALRHYINLVTRQRY
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Nicolas P.,Vaudry H.,Chartrel N.,Mor A.,
- Title:Skin peptide tyrosine-tyrosine, a member of the pancreatic polypeptide family: isolation, structure, synthesis, and endocrine activity.
- Journal:Proc. Natl. Acad. Sci. U.S.A., 1994, 91, 10295-10299 [MEDLINE:95024100]
- [2] Mor A.,Nicolas P.,Shai Y.,Vouldoukis I.,
- Title:Broad spectrum antibiotic activity of the skin-PYY.
- Journal:FEBS Lett., 1996, 380, 237-240 [MEDLINE:96186932]
Comments
- Comments
No comments found on LAMP database