Record in detail


General Info

  • lamp_id:L02A000401
  • Name:Lingual antimicrobial peptide
  • FullName:Lingual antimicrobial peptide
  • Source:Bovine Bos taurus?
  • Mass:4954.9 Da
  • Sequence Length:45 aa
  • Isoelectric Point:11.44
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L01A001371    From 20 To 64 E-value: 2e-21 Score: 92.4
        GFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 2. L02A000401    From 1 To 45 E-value: 2e-20 Score: 89.7
        GFTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 3. L01A001519    From 1 To 44 E-value: 5e-20 Score: 87.8
        FTQGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 4. L11A004351    From 1 To 42 E-value: 2e-18 Score: 83.2
        QGVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK
  • 5. L13A025863    From 1 To 41 E-value: 6e-18 Score: 81.3
        GVRNSQSCRRNKGICVPIRCPGSMRQIGTCLGAQVKCCRRK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: