Record in detail


General Info

  • lamp_id:L02A000438
  • Name:Mussel Defensin MGD-1
  • FullName:Mussel Defensin MGD-1
  • Source:Mediterranean mussel, Mytilus galloprovincialis
  • Mass:4349 Da
  • Sequence Length:39 aa
  • Isoelectric Point:8.59
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRCG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A02572|    From 1 To 39 E-value: 1e-17 Score: 80.5
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCG
  • 2. L02A000438    From 1 To 39 E-value: 1e-17 Score: 80.1
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLPCTCYRCG
  • 3. L03A000031    From 1 To 39 E-value: 9e-17 Score: 77.4
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRCG
  • 4. L01A003021    From 1 To 38 E-value: 3e-16 Score: 75.9
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTCYRC
  • 5. L03A000030    From 1 To 37 E-value: 0.00000000000001 Score: 70.5
        GFGCPNDYPCHRHCKSIPGRCGGYCGGWHRLRCTCYR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: