Record in detail


General Info

  • lamp_id:L02A000535
  • Name:Pilosulin 1
  • FullName:Pilosulin 1
  • Source:venom of Myrmecia pilosula (jumper ant)
  • Mass:6052.4 Da
  • Sequence Length:56 aa
  • Isoelectric Point:11.23
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000535    From 1 To 56 E-value: 8e-26 Score: 107
        GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQEEQQPQ
  • 2. L13A023974    From 1 To 50 E-value: 5e-22 Score: 94.7
        GLGSVFGRLARILGRVIPKVAKKLGPKVAKVLPKVMKEAIPMAVEMAKSQ
  • 3. L01A000648    From 1 To 20 E-value: 0.000006 Score: 41.2
        GLGSVFGRLARILGRVIPKV
  • 4. L13A020370    From 1 To 19 E-value: 0.0005 Score: 35
        GLGSVFGRLARI-GRVIPKV
  • 5. L01A000302    From 1 To 20 E-value: 0.015 Score: 30
        GLLSKFGRLARKLARVIPKV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: