Record in detail


General Info

  • lamp_id:L02A000612
  • Name:Chrombacin
  • FullName:Chrombacin
  • Source:Bos taurus
  • Mass:7057.6 Da
  • Sequence Length:60 aa
  • Isoelectric Point:4.02
  • Activity:Antibacterial
  • Sequence
        AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000612    From 1 To 60 E-value: 3e-29 Score: 118
        AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLELQKIAEKFSQR
  • 2. L13A015582    From 1 To 50 E-value: 2e-23 Score: 99.4
        AAEFPDFYDSEEQMGPHQEAEDEKDRADQRVLTEEEKKELENLAAMDLEL

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments
  •   [1]  a database links to AMPs, is an integrated open-access database. It has been created with an objective to provide a useful resource and tools for AMP studies. AMPs in LAMP are short, of less than 100 amino acid residues and include natural, synthetic and predicted AMPs. AMPs in LAMP had been grouped into three catalogs by data source: experimental, predicted, and patent. This manually curated database currently holds
  •   ----  test@163.com   at  2013-01-14 17:13:28



CAPTCHA Image   Reload Image
Enter Code*: