Record in detail


General Info

  • lamp_id:L02A000626
  • Name:human KS-30
  • FullName:human KS-30
  • Source:human sweat, Homo sapiens
  • Mass:3644.3 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11.37
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011556    From 8 To 37 E-value: 0.00000000001 Score: 60.1
        KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 2. L11A011557    From 8 To 37 E-value: 0.00000000001 Score: 60.1
        KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 3. L12A11486|    From 29 To 58 E-value: 0.00000000001 Score: 60.1
        KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 4. L13A012291    From 8 To 37 E-value: 0.00000000002 Score: 60.1
        KSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L02A000626    From 1 To 30 E-value: 0.00000000002 Score: 59.7
        KSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: