Record in detail


General Info

  • lamp_id:L02A000627
  • Name:human RK-31
  • FullName:human RK-31
  • Source:human sweat, Homo sapiens
  • Mass:3800.5 Da
  • Sequence Length:31 aa
  • Isoelectric Point:11.7
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A011557    From 7 To 37 E-value: 0.000000000004 Score: 62
        RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 2. L11A011556    From 7 To 37 E-value: 0.000000000004 Score: 62
        RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 3. L12A11486|    From 28 To 58 E-value: 0.000000000004 Score: 61.6
        RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 4. L13A012291    From 7 To 37 E-value: 0.000000000005 Score: 61.6
        RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES
  • 5. L02A000624    From 8 To 38 E-value: 0.000000000005 Score: 61.6
        RKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: