Record in detail


General Info

  • lamp_id:L02A000643
  • Name:Pardaxin 3
  • FullName:Pardaxin 3
  • Source:Red Sea moses sole, Pardachirus marmoratus
  • Mass:3429.9 Da
  • Sequence Length:33 aa
  • Isoelectric Point:6.51
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GFFAFIPKIISSPLFKTLLSAVGSALSSSGEQE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000643    From 1 To 33 E-value: 0.000000000001 Score: 63.5
        GFFAFIPKIISSPLFKTLLSAVGSALSSSGEQE
  • 2. L02A000645    From 1 To 33 E-value: 0.000000000002 Score: 62.8
        GFFAFIPKIISSPLFKTLLSAVGSALSSSGDQE
  • 3. L02A000641    From 1 To 33 E-value: 0.000000000004 Score: 61.6
        GFFALIPKIISSPLFKTLLSAVGSALSSSGEQE
  • 4. L01A003097    From 1 To 33 E-value: 0.00000000004 Score: 58.5
        GFFALIPKIISSPLFKTLLSAVGSALSSSGGQE
  • 5. L02A000642    From 1 To 33 E-value: 0.00000000007 Score: 57.8
        GFFALIPKIISSPIFKTLLSAVGSALSSSGGQE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: