Record in detail


General Info

  • lamp_id:L02A000710
  • Name:Mytilusl defensin
  • FullName:Mytilusl defensin
  • Source:mussels, Mytilus edulis
  • Mass:3843.4 Da
  • Sequence Length:35 aa
  • Isoelectric Point:8.62
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GFGCPNDYPCHRHCKSIPGRYGGYCGGAHRLRCTC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000710    From 1 To 35 E-value: 0.000000000000002 Score: 72.8
        GFGCPNDYPCHRHCKSIPGRYGGYCGGAHRLRCTC
  • 2. L02A000709    From 1 To 35 E-value: 0.00000000000001 Score: 70.5
        GFGCPNDYPCHRHCKSIPGRAGGYCGGAHRLRCTC
  • 3. L03A000030    From 1 To 35 E-value: 0.00000000000009 Score: 67.4
        GFGCPNDYPCHRHCKSIPGRCGGYCGGWHRLRCTC
  • 4. L12A02572|    From 1 To 35 E-value: 0.0000000000005 Score: 64.7
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTC
  • 5. L01A003021    From 1 To 35 E-value: 0.000000000001 Score: 63.5
        GFGCPNNYQCHRHCKSIPGRCGGYCGGWHRLRCTC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: