Record in detail


General Info

  • lamp_id:L02A000732
  • Name:Penguin AvBD103a
  • FullName:Penguin AvBD103a
  • Source:King Penguin stomach, Aptenodytes patagonicus
  • Mass:4428.2 Da
  • Sequence Length:38 aa
  • Isoelectric Point:11.96
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        SFGLCRLRRGSCAHGRCRFPSIPIGRCSRFVQCCRRVW
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000732    From 1 To 38 E-value: 3e-16 Score: 75.5
        SFGLCRLRRGSCAHGRCRFPSIPIGRCSRFVQCCRRVW
  • 2. L01A002914    From 1 To 38 E-value: 0.000000000000001 Score: 73.2
        SFGLCRLRRGFCAHGRCRFPSIPIGRCSRFVQCCRRVW
  • 3. L01A002915    From 1 To 38 E-value: 0.00000000000001 Score: 70.5
        SFGLCRLRRGFCARGRCRFPSIPIGRCSRFVQCCRRVW
  • 4. L03A000258    From 25 To 58 E-value: 0.000008 Score: 40.8
        CRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY
  • 5. L05ADEF299    From 25 To 58 E-value: 0.000008 Score: 40.8
        CRIRGGFCRVGSCRFPHIAIGKCATFISCCGRAY

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: