Record in detail


General Info

  • lamp_id:L02A000751
  • Name:Galleria defensin
  • FullName:Galleria defensin
  • Source:wax moth, Galleria mellonella
  • Mass:4720.2 Da
  • Sequence Length:43 aa
  • Isoelectric Point:7.03
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06285|    From 30 To 72 E-value: 7e-22 Score: 94.4
        DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE
  • 2. L02A000751    From 1 To 43 E-value: 8e-21 Score: 90.9
        DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE
  • 3. L01A000176    From 1 To 43 E-value: 8e-21 Score: 90.5
        DTLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFLNVNCWCE
  • 4. L01A000177    From 1 To 43 E-value: 2e-19 Score: 86.3
        DKLIGSCVWGATNYTSDCNAECKRRGYKGGHCGSFWNVNCWCE
  • 5. L01A003214    From 1 To 43 E-value: 2e-19 Score: 85.9
        DKLIGSCVWGAVNYTSNCNAECKRRGYKGGHCGSFLNVNCWCE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: