Record in detail


General Info

  • lamp_id:L02A000833
  • Name:Human drosomycin-like defensin
  • FullName:Human drosomycin-like defensin
  • Source:Homo sapiens
  • Mass:4751.4 Da
  • Sequence Length:43 aa
  • Isoelectric Point:8.91
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A000833    From 1 To 43 E-value: 9e-20 Score: 87
        CLAGRLDKQCTCRRSQPSRRSGHEVGRPSPHCGPSRQCGCHMD
  • 2. L03A000197    From 28 To 68 E-value: 0.001 Score: 33.5
        CLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCE
  • 3. L01A000075    From 2 To 42 E-value: 0.004 Score: 32
        CLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCE
  • 4. L13A022558    From 1 To 41 E-value: 0.004 Score: 32
        CLSGRYKGPCAVWDNETCRRVCKEEGRSSGHCSPSLKCWCE
  • 5. L02A001551    From 2 To 42 E-value: 0.039 Score: 28.5
        CLSGKYKGPCAVWDNEMCRRICKEEGHISGHCSPSLKCWCE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: