Record in detail


General Info

  • lamp_id:L02A000851
  • Name:Plantaricin 423
  • FullName:Plantaricin 423
  • Source:Lactobacillus plantarum 423
  • Mass:3935.4 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.67
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KYYGNGVTCGKHSCSVNWGQAFSCSVSHLANFGHGKC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08471|    From 20 To 56 E-value: 2e-17 Score: 79.3
        KYYGNGVTCGKHSCSVNWGQAFSCSVSHLANFGHGKC
  • 2. L02A000851    From 1 To 37 E-value: 1e-16 Score: 76.6
        KYYGNGVTCGKHSCSVNWGQAFSCSVSHLANFGHGKC
  • 3. L12A06769|    From 20 To 56 E-value: 0.0000000000002 Score: 65.9
        RYYGNGVTCGKHKCTVNWGQAWTCGVNRLANFGHGNC
  • 4. L12A08173|    From 19 To 55 E-value: 0.00000000002 Score: 59.7
        KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC
  • 5. L12A08150|    From 19 To 55 E-value: 0.00000000002 Score: 59.7
        KYYGNGVSCNSHGCSVNWGQAWTCGVNHLANGGHGVC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: