Record in detail


General Info

  • lamp_id:L02A000989
  • Name:VrCRP
  • FullName:VrCRP
  • Source:a bruchid-resistant mungbean, V. radiata
  • Mass:5123 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.59
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L03A000114    From 28 To 73 E-value: 5e-22 Score: 94.7
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 2. L02A000989    From 1 To 46 E-value: 7e-22 Score: 94.4
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCKGMTRTCYCLVNC
  • 3. L01A002676    From 1 To 46 E-value: 2e-21 Score: 92.8
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 4. L02A000715    From 1 To 45 E-value: 2e-19 Score: 86.3
        RTCM-KKEGWGKCLIDTTCAHSCKNRGYIGGNCKGMTRTCYCLVNC
  • 5. L11A005878    From 3 To 44 E-value: 7e-18 Score: 80.9
        RTCMIKKEGWGKCLIDTTCAHSCKNRGYIGGDCK----TCYCLVNC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: