Record in detail


General Info

  • lamp_id:L02A001027
  • Name:Varv peptide B
  • FullName:Varv peptide B
  • Source:Viola arvensis
  • Mass:3093.5 Da
  • Sequence Length:30 aa
  • Isoelectric Point:4.19
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        TCFGGTCNTPGCSCDPWPMCSRNGLPVCGE
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1027

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001027    From 1 To 30 E-value: 0.000000000002 Score: 63.2
        TCFGGTCNTPGCSCDPWPMCSRNGLPVCGE
  • 2. L02A001032    From 1 To 30 E-value: 0.00000000001 Score: 60.5
        TCFGGTCNTPGCSCDPWPVCSRNGVPVCGE
  • 3. L02A001033    From 1 To 30 E-value: 0.00000000006 Score: 57.8
        TCFGGTCNTPGCSCETWPVCSRNGLPVCGE
  • 4. L02A001785    From 3 To 30 E-value: 0.0000000003 Score: 55.8
        TCFGGTCNTPGCTCDPWPVCTRNGLPVC
  • 5. L02A001057    From 4 To 30 E-value: 0.000000002 Score: 53.1
        TCFGGTCNTPGCICDPWPVCTRNGLPV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: