Record in detail


General Info

  • lamp_id:L02A001055
  • Name:Cycloviolacin H4
  • FullName:Cycloviolacin H4
  • Source:Austalian native violet Viola hederaceae
  • Mass:3121.6 Da
  • Sequence Length:30 aa
  • Isoelectric Point:3.85
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        CAESCVWIPCTVTALLGCSCSNNVCYNGIP
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1055
  •   2  Database:SATPdb  satpdb12875

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001055    From 1 To 30 E-value: 0.000000000005 Score: 61.6
        CAESCVWIPCTVTALLGCSCSNNVCYNGIP
  • 2. L12A00777|    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        CAESCVWIPCTVTALLGCSCSNKVCYNGIP
  • 3. L02A001035    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        CAESCVYIPCTVTALLGCSCSNRVCYNGIP
  • 4. L12A06260|    From 48 To 75 E-value: 0.0000000002 Score: 55.8
        CAESCVWIPCTITALMGCSCKNNVCYNN
  • 5. L06AT00160    From 4 To 30 E-value: 0.0000000005 Score: 55.1
        CAESCVWIPCTVTALLGCSCSNNVCYN

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: