Record in detail


General Info

  • lamp_id:L02A001061
  • Name:Circulin D
  • FullName:Circulin D
  • Source:tropical tree Chassalia parvifolia
  • Mass:3548.2 Da
  • Sequence Length:31 aa
  • Isoelectric Point:7.76
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        CGESCVWIPCVTSIFNCKCKENKVCYHDKIP
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1061

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001061    From 1 To 31 E-value: 0.0000000000003 Score: 65.5
        CGESCVWIPCVTSIFNCKCKENKVCYHDKIP
  • 2. L13A023334    From 4 To 31 E-value: 0.00000000001 Score: 60.1
        CGESCVWIPCVTSIFNCKCKENKVCYHD
  • 3. L13A022756    From 4 To 31 E-value: 0.00000000001 Score: 60.1
        CGESCVWIPCVTSIFNCKCKENKVCYHD
  • 4. L02A001062    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        CGESCVWIPCLTSVFNCKC-ENKVCYHDKIP
  • 5. L01A002722    From 4 To 30 E-value: 0.000000001 Score: 53.5
        CGESCVWIPCVTSIFNCKC-ENKVCYHD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: