Record in detail


General Info

  • lamp_id:L02A001083
  • Name:Hyfl B
  • FullName:Hyfl B
  • Source:Australian Hybanthus floribundus E
  • Mass:3466 Da
  • Sequence Length:32 aa
  • Isoelectric Point:4.48
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001083    From 1 To 32 E-value: 0.0000000000001 Score: 67
        GSPIQCAETCFIGKCYTEELGCTCTAFLCMKN
  • 2. L02A001084    From 1 To 32 E-value: 0.0000000000007 Score: 64.3
        GSPRQCAETCFIGKCYTEELGCTCTAFLCMKN
  • 3. L11A009054    From 1 To 30 E-value: 0.0002 Score: 36.6
        GSVIKCGESCLLGKCYTP--GCTCSRPICKKN
  • 4. L12A04042|    From 1 To 30 E-value: 0.0002 Score: 36.6
        GSAIRCGESCLLGKCYTP--GCTCDRPICKKN
  • 5. L13A024065    From 1 To 30 E-value: 0.0004 Score: 35.4
        GSVIKCGESCLLGKCYTP--GCTCSRPICKKD

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: