Record in detail


General Info

  • lamp_id:L02A001090
  • Name:Hyfl I
  • FullName:Hyfl I
  • Source:Australian Hybanthus floribundus W
  • Mass:3123.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GIPCGESCVFIPCISGVIGCSCKSKVCYRN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001090    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        GIPCGESCVFIPCISGVIGCSCKSKVCYRN
  • 2. L12A05610|    From 63 To 91 E-value: 0.00000000002 Score: 59.3
        IPCGESCVFIPCISSVLGCSCKNKVCYRN
  • 3. L12A04828|    From 1 To 29 E-value: 0.00000000003 Score: 58.9
        IPCGESCVFIPCITGAIGCSCKSKVCYRN
  • 4. L02A001774    From 1 To 30 E-value: 0.00000000005 Score: 58.2
        GIPCGESCVFIPCITGAIGCSCKSKVCYRN
  • 5. L12A04827|    From 1 To 29 E-value: 0.00000000007 Score: 57.8
        IPCGESCVFIPCISTVIGCSCKNKVCYRN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: