Record in detail


General Info

  • lamp_id:L02A001092
  • Name:Hyfl K
  • FullName:Hyfl K
  • Source:Australian Hybanthus floribundus W
  • Mass:3174.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:6.07
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001092    From 1 To 30 E-value: 0.000000000003 Score: 62.4
        GTPCGESCVYIPCFTAVVGCTCKDKVCYLN
  • 2. L02A001093    From 1 To 30 E-value: 0.00000000006 Score: 57.8
        GTPCAESCVYLPCFTGVIGCTCKDKVCYLN
  • 3. L12A04173|    From 1 To 30 E-value: 0.0000000007 Score: 54.3
        GTPCGESCVYIPCISGVIGCSCTDKVCYLN
  • 4. L12A05611|    From 64 To 93 E-value: 0.000000002 Score: 52.8
        GVPCGESCVWIPCLTSIVGCSCKNNVCTLN
  • 5. L06AT00201    From 1 To 30 E-value: 0.000000002 Score: 52.8
        GTPCGSSCVYIPCISGVIGCSCTDKVCYLN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: