Record in detail


General Info

  • lamp_id:L02A001094
  • Name:Hyfl M
  • FullName:Hyfl M
  • Source:Australian Hybanthus floribundus W
  • Mass:3209.6 Da
  • Sequence Length:29 aa
  • Isoelectric Point:4.19
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GNIPCGESCIFFPCFNPGCSCKDNLCYYN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001094    From 1 To 29 E-value: 0.00000000001 Score: 60.5
        GNIPCGESCIFFPCFNPGCSCKDNLCYYN
  • 2. L12A00015|    From 53 To 81 E-value: 0.0000006 Score: 44.7
        GEIPCGESCVYLPCFLPNCYCRNHVCYLN
  • 3. L02A001085    From 1 To 31 E-value: 0.000001 Score: 43.5
        GSVPCGESCVYIPCFTGIAGCSCKSKVCYYN
  • 4. L12A05610|    From 61 To 91 E-value: 0.000002 Score: 43.1
        GVIPCGESCVFIPCISSVLGCSCKNKVCYRN
  • 5. L12A12205|    From 57 To 87 E-value: 0.000002 Score: 42.7
        GTIPCGESCVFIPCLTSAIGCSCKSKVCYKN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: