Record in detail


General Info

  • lamp_id:L02A001108
  • Name:kalata B9
  • FullName:kalata B9
  • Source:African plant Oldenlandia affinis DC (Rubiaceae)
  • Mass:3296.7 Da
  • Sequence Length:31 aa
  • Isoelectric Point:6.07
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001108    From 1 To 31 E-value: 0.000000000001 Score: 63.5
        GSVFNCGETCVLGTCYTPGCTCNTYRVCTKD
  • 2. L01A003081    From 1 To 31 E-value: 0.0000000002 Score: 56.2
        GSVLNCGETCLLGTCYTTGCTCNKYRVCTKD
  • 3. L12A00828|    From 1 To 26 E-value: 0.00000004 Score: 48.5
        CGETCLLGTCYTTGCTCNKYRVCTKD
  • 4. L01A002725    From 2 To 29 E-value: 0.0000009 Score: 43.9
        GTIFDCGETCFLGTCYTPGCSCGNYGFC
  • 5. L02A001145    From 2 To 29 E-value: 0.000003 Score: 42.4
        GTIFDCGESCFLGTCYTKGCSCGEWKLC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: