Record in detail


General Info

  • lamp_id:L02A001125
  • Name:Vibi I
  • FullName:Vibi I
  • Source:alpine violet Viola biflora
  • Mass:3194.7 Da
  • Sequence Length:30 aa
  • Isoelectric Point:8.11
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001125    From 1 To 30 E-value: 0.000000000004 Score: 62
        GIPCGESCVWIPCLTSTVGCSCKSKVCYRN
  • 2. L06AT00184    From 1 To 30 E-value: 0.00000000001 Score: 60.5
        GIPCGESCVWIPCLTSAVGCSCKSKVCYRN
  • 3. L06AT00178    From 1 To 30 E-value: 0.00000000001 Score: 60.1
        GIPCGESCVWIPCLTSAIGCSCKSKVCYRN
  • 4. L02A001144    From 1 To 30 E-value: 0.00000000003 Score: 59.3
        GIPCGESCVWIPCITSAIGCSCKSKVCYRN
  • 5. L06AT00162    From 1 To 30 E-value: 0.00000000003 Score: 58.9
        GIPCGESCVYIPCLTSAVGCSCKSKVCYRN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: