Record in detail


General Info

  • lamp_id:L02A001151
  • Name:Lactococcin G-a
  • FullName:Lactococcin G-a
  • Source:Lactococcus lactis LMGT2081
  • Mass:4309.9 Da
  • Sequence Length:39 aa
  • Isoelectric Point:10.84
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001151    From 1 To 39 E-value: 1e-17 Score: 80.1
        GTWDDIGQGIGRVAYWVGKALGNLSDVNQASRINRKKKH
  • 2. L11A003541    From 2 To 40 E-value: 2e-17 Score: 79.3
        GTWDDIGQGIGRVAYWVGKAMGNMSDVNQASRINRKKKH
  • 3. L04ABAC129    From 1 To 39 E-value: 2e-17 Score: 79.3
        GTWDDIGQGIGRVAYWVGKAMGNMSDVNQASRINRKKKH
  • 4. L11A003626    From 1 To 39 E-value: 6e-17 Score: 77.8
        GTWDDIGQGIGRVAYWVGKGLGNMSDVNQASRINRKKKH
  • 5. L11A003623    From 1 To 39 E-value: 9e-17 Score: 77.4
        GTWDDIGQGIGRVAYWVGKAMGNMSDVNQADRINRKKKH

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: