Record in detail


General Info

  • lamp_id:L02A001155
  • Name:Enterocin 1071
  • FullName:Enterocin 1071
  • Source:Enterococcus faecalis BFE 1071
  • Mass:4285.9 Da
  • Sequence Length:39 aa
  • Isoelectric Point:10.48
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08198|    From 19 To 57 E-value: 1e-18 Score: 83.6
        ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
  • 2. L04ABAC106    From 19 To 57 E-value: 2e-18 Score: 83.2
        ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
  • 3. L02A001155    From 1 To 39 E-value: 2e-18 Score: 82.4
        ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
  • 4. L11A003569    From 1 To 38 E-value: 1e-17 Score: 80.5
        SVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKKH
  • 5. L11A003641    From 1 To 38 E-value: 2e-17 Score: 79.7
        ESVFSKIGNAVGPAAYWILKGLGNMSDVNQADRINRKK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: