Record in detail


General Info

  • lamp_id:L02A001169
  • Name:Lactacin F
  • FullName:Lactacin F
  • Source:Lactobacillus johnsonii VPI11088 (Laf+)
  • Mass:4736.3 Da
  • Sequence Length:48 aa
  • Isoelectric Point:8.77
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08084|    From 15 To 62 E-value: 6e-23 Score: 97.8
        NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
  • 2. L02A001169    From 1 To 48 E-value: 1e-22 Score: 96.7
        NRWGDTVLSAASGAGTGIKACKSFGPWGMAICGVGGAAIGGYFGYTHN
  • 3. L12A06314|    From 18 To 65 E-value: 0.000000000003 Score: 62.4
        NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN
  • 4. L04ABAC112    From 1 To 48 E-value: 0.000000000004 Score: 61.6
        NKWGNAVIGAATGATRGVSWCRGFGPWGMTACALGGAAIGGYLGYKSN
  • 5. L12A09518|    From 19 To 66 E-value: 0.46 Score: 25
        NAPGDAVIGGLGGLASGLKFCKLPHPVLTGGCVVGFTVGGAYLGYTAN

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: