Record in detail


General Info

  • lamp_id:L02A001172
  • Name:ABP-118
  • FullName:ABP-118
  • Source:Lactobacillus salivarius subsp. salivarius UCC118
  • Mass:4096.8 Da
  • Sequence Length:45 aa
  • Isoelectric Point:8.83
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08470|    From 20 To 64 E-value: 7e-19 Score: 84.3
        KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL
  • 2. L02A001172    From 1 To 45 E-value: 2e-18 Score: 82.8
        KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL
  • 3. L13A028710    From 1 To 44 E-value: 5e-18 Score: 81.3
        KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTC
  • 4. L11A001529    From 1 To 44 E-value: 1e-17 Score: 80.5
        RGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL
  • 5. L11A001534    From 1 To 45 E-value: 0.00000000005 Score: 58.2
        KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGLVGGALTCL

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: