Record in detail


General Info

  • lamp_id:L02A001175
  • Name:Lactocin 705
  • FullName:Lactocin 705
  • Source:Lactobacillus casei CRL 705
  • Mass:3578.1 Da
  • Sequence Length:33 aa
  • Isoelectric Point:10.36
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06640|    From 22 To 54 E-value: 0.00000000000003 Score: 68.9
        GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY
  • 2. L02A001175    From 1 To 33 E-value: 0.00000000000005 Score: 68.2
        GMSGYIQGIPDFLKGYLHGISAANKHKKGRLGY
  • 3. L04ABAC041    From 1 To 31 E-value: 0.0000000000007 Score: 64.3
        GMSGYIQGIPDFLKGYLHGISAANKHKKGRL
  • 4. L13A020576    From 1 To 30 E-value: 0.000000000002 Score: 62.8
        GMSGYIQGIPDFLKGYLHGISAANKHKKGR
  • 5. L12A09086|    From 19 To 35 E-value: 6.4 Score: 21.2
        SGFTQGISDFASCHTNG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: