Record in detail


General Info

  • lamp_id:L02A001193
  • Name:Halocin C8
  • FullName:Halocin C8
  • Source:Halobacterium strain AS7092
  • Mass:7441.5 Da
  • Sequence Length:76 aa
  • Isoelectric Point:3.94
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEIVCTVADEYSGCGDAVAKEACNRAGLC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001193    From 1 To 76 E-value: 3e-37 Score: 145
        DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEIVCTVADEYSGCGDAVAKEACNRAGLC
  • 2. L12A01076|    From 1 To 68 E-value: 2e-23 Score: 99.4
        DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSSLGFFVITCTTSADYYSIPDSNAAK
  • 3. L13A012949    From 1 To 50 E-value: 2e-22 Score: 95.9
        DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEI
  • 4. L01A002793    From 1 To 15 E-value: 0.003 Score: 32.7
        DIDITGCSACKYAAG
  • 5. L12A09385|    From 41 To 58 E-value: 8.9 Score: 20.8
        RFKSWSLCTPGCARTGSF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: