Record in detail
General Info
- lamp_id:L02A001215
- Name:ABAE_BOMPA
- FullName:Abaecin
- Source:Bombus pascuorum
- Mass:4501.1 Da
- Sequence Length:39 aa
- Isoelectric Point:10.18
- Activity:Antibacterial,Antifungal,Antiviral,
- Sequence
FVPYNPPRPYQSKPFPSFPGHGPFNPKIQWPYPLPNPGH - Function:Antibacterial peptide against Gram-positive and Gram-negative bacteria.
Cross-Linking
- Cross-linking
- 1 Database:APD 1215
- 2 Database:CAMP CAMPSQ3114
- 3 Database:dbAMP dbAMP_02389
- 4 Database:SATPdb satpdb23210
- 5 Database:Uniprot P81463
Top similar AMPs
- Top similar AMPs on LAMP
- 1. L02A001215 From 1 To 39 E-value: 2e-16 Score: 75.9
FVPYNPPRPYQSKPFPSFPGHGPFNPKIQWPYPLPNPGH - 2. L12A07774| From 20 To 58 E-value: 4e-16 Score: 75.1
FVPYNPPRPGQSKPFPTFPGHGPFNPKIQWPYPLPNPGH - 3. L01A000411 From 1 To 39 E-value: 0.000000000000002 Score: 73.2
FVPYNPPRPGQSKPFPSFPGHGPFNPKIQWPYPLPNPGH - 4. L12A12029| From 5 To 43 E-value: 0.000000000000007 Score: 71.2
FVPYNPPRPGQSKPFPTFPGHGPFNPKTQWPYPLPNPGH - 5. L12A11882| From 1 To 38 E-value: 0.00000000000003 Score: 68.9
VPYNPPRPGQSKPFPTFPGHGPFNPKTQWPYPLPNPGH
Structure
- Domains
- 1 Name:Abaecin_antimicrobial_peptide Interpro Link:IPR012524
- Structures
No structs found on LAMP database
Activity
- Antibacterial Activities
No MICs found on LAMP database
Toxicity
- Toxicity
No toxicity records found on LAMP database
Reference
- Reference
- [1] Bulet P.,Moniatte M.,Rees J.A.,
- Title:Novel antibacterial peptides isolated from a European bumblebee, Bombus pascuorum (Hymenoptera, Apoidea).
- Journal:Insect Biochem. Mol. Biol., 1997, 27, 413-422 [MEDLINE:97362903]
Comments
- Comments
No comments found on LAMP database