Record in detail


General Info

  • lamp_id:L02A001243
  • Name:Cy-AMP1
  • FullName:Cy-AMP1
  • Source:the cycad seeds, Cycas revoluta
  • Mass:4591.3 Da
  • Sequence Length:44 aa
  • Isoelectric Point:8.2
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KGAPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L11A005262    From 3 To 46 E-value: 7e-20 Score: 87.4
        KGAPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG
  • 2. L02A001243    From 1 To 44 E-value: 8e-20 Score: 87.4
        KGAPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG
  • 3. L11A005263    From 3 To 46 E-value: 3e-19 Score: 85.9
        KGAPCAKKPCCGPLGHYKVDCSTIPDYPCCGKYGFCGSGPQYCG
  • 4. L02A001244    From 1 To 44 E-value: 3e-19 Score: 85.5
        KGGPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQYCG
  • 5. L11A005268    From 3 To 46 E-value: 3e-19 Score: 85.5
        KGAPCAKKPCCGPLGHYKVDCSTIPDYPCCSKYGFCGSGPQVCG

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: