Record in detail


General Info

  • lamp_id:L02A001255
  • Name:Brevinin-2PRc
  • FullName:Brevinin-2PRc
  • Source:the Hokkaido frog, Rana pirica, Asia
  • Mass:3818.6 Da
  • Sequence Length:37 aa
  • Isoelectric Point:10.51
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GLMSVTKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001255    From 1 To 37 E-value: 7e-16 Score: 74.3
        GLMSVTKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC
  • 2. L102633000    From 1 To 37 E-value: 0.000000000000003 Score: 72
        GLMSVLKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC
  • 3. L02A001256    From 1 To 37 E-value: 0.000000000000007 Score: 70.9
        GLMSVLKGVLKTAGKHIFKNVGGSLLDQAKCKITGQC
  • 4. L102635000    From 1 To 37 E-value: 0.000000000000009 Score: 70.5
        GLLSVLKGVLKTAGKHIFKNVGGSLLDQAKCKISGQC
  • 5. L13A019916    From 1 To 37 E-value: 0.00000000000002 Score: 69.7
        GLLSVLKGVLKTAGKHIFKNVGGSLLDQAKCKISGEC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: