Record in detail


General Info

  • lamp_id:L02A001271
  • Name:Palustrin-3AR
  • FullName:Palustrin-3AR
  • Source:the crawfish frog, Rana areolata, North America
  • Mass:4647.5 Da
  • Sequence Length:45 aa
  • Isoelectric Point:10.51
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001271    From 1 To 45 E-value: 8e-20 Score: 87.4
        GIFPKIIGKGIVNGIKSLAKGVGMKVFKAGLNNIGNTGCNNRDEC
  • 2. L12A07029|    From 39 To 86 E-value: 0.000000000000001 Score: 73.2
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGC-NEDEC
  • 3. L01A000569    From 1 To 48 E-value: 0.000000000000004 Score: 71.6
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLNNIGNTGC-NEDEC
  • 4. L01A000559    From 1 To 48 E-value: 0.00000000000001 Score: 70.5
        GIFPKIIGKGIKTGIVNGIKSLVKGVGMKVFKAGLSNIGNTGC-NEDEC
  • 5. L12A07028|    From 39 To 86 E-value: 0.00000000000001 Score: 70.1
        GIFPKIIGKGIKTGIVNGIKNLVKGVGMKVFKAGLSNIGNTGC-NEDEC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: