Record in detail


General Info

  • lamp_id:L02A001281
  • Name:Viscotoxin A2
  • FullName:Viscotoxin A2
  • Source:Viscum album L
  • Mass:4833.4 Da
  • Sequence Length:46 aa
  • Isoelectric Point:8.87
  • Activity:Antibacterial,Antifungal,Antiviral,,Anticancer
  • Sequence
        KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001281    From 1 To 46 E-value: 1e-21 Score: 93.6
        KSCCPNTTGRNIYNTCRFGGGSRQVCASLSGCKIISASTCPSDYPK
  • 2. L02A001278    From 1 To 46 E-value: 1e-20 Score: 90.1
        KSCCPNTTGRNIYNTCRFGGGSREVCARISGCKIISASTCPSDYPK
  • 3. L02A001282    From 1 To 46 E-value: 5e-20 Score: 88.2
        KSCCPNTTGRNIYNTCRLGGGSRERCASLSGCKIISASTCPSDYPK
  • 4. L02A001280    From 1 To 46 E-value: 1e-19 Score: 87
        KSCCPNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDYPK
  • 5. L02A001284    From 1 To 46 E-value: 6e-19 Score: 84.7
        KSCCKNTTGRNIYNTCRFAGGSRERCAKLSGCKIISASTCPSDYPK

Structure

  •   Domains

    •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

    •     No MICs found on LAMP database

Toxicity

  •   Toxicity

    •     No toxicity records found on LAMP database

Reference

  •   Reference

    •     No references found on LAMP database

Comments

  •   Comments

    •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: