Record in detail


General Info

  • lamp_id:L02A001287
  • Name:P15
  • FullName:P15
  • Source:New Zealand deer, blood, Cervus elaphus
  • Mass:3489.2 Da
  • Sequence Length:30 aa
  • Isoelectric Point:11.26
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        IRNSLTCRFNFGICLPKRCPGRMRQIGTCF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001287    From 1 To 30 E-value: 0.000000000002 Score: 62.8
        IRNSLTCRFNFGICLPKRCPGRMRQIGTCF
  • 2. L12A09074|    From 25 To 54 E-value: 0.00000007 Score: 47.8
        ISNPLSCRRNKGICLPIRCPGSMRQIGTCF
  • 3. L03A000069    From 18 To 47 E-value: 0.00000008 Score: 47.8
        VRNHVTCRINRGFCVPIRCPGRTRQIGTCF
  • 4. L01A000363    From 3 To 32 E-value: 0.0000001 Score: 47.4
        VRNHVTCRINRGFCVPIRCPGRTRQIGTCF
  • 5. L12A09900|    From 4 To 33 E-value: 0.0000001 Score: 47
        VRNPQSCRWNMGVCIPISCPGNMRQIGTCF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: