Record in detail


General Info

  • lamp_id:L02A001340
  • Name:Naegleriapore A
  • FullName:Naegleriapore A
  • Source:pathogenic protozoon Naegleria fowleri
  • Mass:8705 Da
  • Sequence Length:78 aa
  • Isoelectric Point:6.22
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        DAECEICKFVIQQVEAFIESNHSQAEIQKELNKLCSSVPSITQTCLSIARMVPYIIKKLEEHNSPGQVCQGLHLCKSS
  • Function:

Cross-Linking

  •   Cross-linking
  •   1  Database:APD  1340
  •   2  Database:dbAMP  dbAMP_00971

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001340    From 1 To 78 E-value: 4.00001e-41 Score: 157
        DAECEICKFVIQQVEAFIESNHSQAEIQKELNKLCSSVPSITQTCLSIARMVPYIIKKLEEHNSPGQVCQGLHLCKSS
  • 2. L12A00970|    From 1 To 79 E-value: 1e-39 Score: 153
        DAECEICKFVIQQVEAFIESNHSQAEIQKELNKLCSSVPSIFTQTCLSIARMVPYIIKKLEEHNSPGQVCQGLHLCKSS
  • 3. L13A026462    From 1 To 50 E-value: 1e-23 Score: 100
        DAECEICKFVIQQVEAFIESNHSQAEIQKELNKLCSSVPSITQTCLSIAR
  • 4. L01A002954    From 1 To 34 E-value: 0.00000000000003 Score: 68.9
        DAECEICKFVIQQVEAFIESNHSQAEIQKELNKL
  • 5. L13A018114    From 1 To 33 E-value: 0.0000000000001 Score: 67
        DAECEICKFVIQQVEAFIESNHSQAEIQKELNK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: