Record in detail


General Info

  • lamp_id:L02A001352
  • Name:Dermaseptin H5
  • FullName:Dermaseptin H5
  • Source:Phyllomedusa hypochondrialis az
  • Mass:2769.2 Da
  • Sequence Length:28 aa
  • Isoelectric Point:9.45
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GLWSTIKNVGKEAAIAAGKAVLGSLGEQ
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A05358|    From 41 To 68 E-value: 0.0000000002 Score: 56.2
        GLWSTIKNVGKEAAIAAGKAVLGSLGEQ
  • 2. L02A001352    From 1 To 28 E-value: 0.0000000007 Score: 54.3
        GLWSTIKNVGKEAAIAAGKAVLGSLGEQ
  • 3. L01A003280    From 1 To 25 E-value: 0.00000005 Score: 48.5
        GLWSTIKNVGKEAAIAAGKAVLGSL
  • 4. L13A024422    From 1 To 24 E-value: 0.0000002 Score: 46.6
        GLWSTIKNVGKEAAIAAGKAVLGS
  • 5. L03A000083    From 46 To 75 E-value: 0.001 Score: 33.5
        GMWSTIRNVGKSAAKAANLPAKAALGAISE

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: