Record in detail


General Info

  • lamp_id:L02A001377
  • Name:Piscidin 4
  • FullName:Piscidin 4
  • Source:hybrid striped bass (Morone chrysops female x M. saxatilis male)
  • Mass:5313.9 Da
  • Sequence Length:44 aa
  • Isoelectric Point:11.76
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A07790|    From 23 To 66 E-value: 4e-22 Score: 95.1
        FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP
  • 2. L02A001377    From 1 To 44 E-value: 2e-21 Score: 93.2
        FFRHLFRGAKAIFRGARQGWRAHKVVSRYRNRDVPETDNNQEEP
  • 3. L01A001251    From 1 To 44 E-value: 2e-20 Score: 89.7
        FFRHLFRGAKAIFRGARQGXRAHKVVSRYRNRDVPETDNNQEEP
  • 4. L12A07791|    From 27 To 56 E-value: 0.0000000005 Score: 55.1
        LFRGAKAIFRGARQGWRSHKAVSRYRARYV
  • 5. L12A05777|    From 5 To 34 E-value: 0.000000001 Score: 53.9
        LFRGAKAIFRGARQGWRSHKAVSRYRARYV

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: