Record in detail


General Info

  • lamp_id:L02A001548
  • Name:Duck AvBD9
  • FullName:Duck AvBD9
  • Source:Peking duck, Anas platyrhynchos
  • Mass:4430 Da
  • Sequence Length:42 aa
  • Isoelectric Point:8.64
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001548    From 1 To 42 E-value: 1e-19 Score: 86.7
        ADTLACRQSHQSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 2. L05ADEF298    From 26 To 67 E-value: 2e-19 Score: 85.9
        ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 3. L07APD0081    From 1 To 42 E-value: 8e-19 Score: 84
        ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 4. L12A09035|    From 27 To 67 E-value: 2e-18 Score: 82.8
        DTLACRQGHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS
  • 5. L02A001146    From 1 To 41 E-value: 2e-18 Score: 82.4
        DTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCCKWAPSS

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: