Record in detail


General Info

  • lamp_id:L02A001549
  • Name:AvBD10
  • FullName:AvBD10
  • Source:liver, Peking duck, Anas platyrhynchos
  • Mass:5464.1 Da
  • Sequence Length:55 aa
  • Isoelectric Point:7.76
  • Activity:Antibacterial,Antifungal,Antiviral,,,Insecticidal
  • Sequence
        VLLFLFQAAPGSADAPFADTAACRSQGNFCRAGACPPTFAASGSCHGGLLNCCAK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001549    From 1 To 55 E-value: 3e-26 Score: 108
        VLLFLFQAAPGSADAPFADTAACRSQGNFCRAGACPPTFAASGSCHGGLLNCCAK
  • 2. L13A023497    From 1 To 50 E-value: 3e-23 Score: 98.6
        VLLFLFQAAPGSADAPFADTAACRSQGNFCRAGACPPTFAASGSCHGGLL
  • 3. L01A003415    From 1 To 39 E-value: 0.000000000000003 Score: 72.4
        FPDTVACRTQGNFCRAGACPPTFTISGQCHGGLLNCCAK
  • 4. L02A001147    From 1 To 37 E-value: 0.00000000000002 Score: 69.7
        DTVACRIQGNFCRAGACPPTFTISGQCHGGLLNCCAK
  • 5. L05ADEF298    From 10 To 61 E-value: 0.000006 Score: 41.2
        VLFFLFQAAPAYSQED-ADTLACRQSHGSCSFVACRAPSVDIGTCRGGKLKCC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: