Record in detail


General Info

  • lamp_id:L02A001565
  • Name:Drosophila diptericin
  • FullName:Drosophila diptericin
  • Source:fruit fly, Drosophila melanogaster
  • Mass:8831.6 Da
  • Sequence Length:83 aa
  • Isoelectric Point:6.8
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001565    From 1 To 83 E-value: 4.06377e-44 Score: 168
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
  • 2. L01A000088    From 1 To 83 E-value: 2.00386e-43 Score: 166
        DDMTMKPTPPPQYPLNLQGGGGGQSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRFPNF
  • 3. L12A01007|    From 1 To 80 E-value: 3.00018e-42 Score: 162
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIGLNGGYGQHLGGPYGNSEPSWKVGSTYTYRF
  • 4. L13A020729    From 1 To 50 E-value: 1e-24 Score: 103
        DDMTMKPTPPPQYPLNLQGGGGGGSGDGFGFAVQGHQKVWTSDNGRHEIG
  • 5. L01A002945    From 7 To 82 E-value: 2e-19 Score: 86.3
        ILPTPAPPNLPQLVGGGGGNRKDGFGVSVDAHQKVWTSDNGRHSIGVTPGYSQHLGGPYGNSRPDYRIGAGYSYNF

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: