Record in detail


General Info

  • lamp_id:L02A001582
  • Name:Psacotheasin
  • FullName:Psacotheasin
  • Source:the yellow-spotted long-horned beetle, Psacothea hilaris
  • Mass:3480 Da
  • Sequence Length:34 aa
  • Isoelectric Point:8.12
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001582    From 1 To 34 E-value: 0.00000000000001 Score: 70.5
        CIAKGNGCQPSGVQGNCCSGHCHKEPGWVAGYCK
  • 2. L01A002684    From 1 To 34 E-value: 0.000000000006 Score: 61.2
        CIANRNGCQPDGSQGNCCSGYCHKEPGWVAGYCR
  • 3. L01A002685    From 1 To 34 E-value: 0.00000000001 Score: 60.5
        CIKNGNGCQPNGSQGNCCSGYCHKQPGWVAGYCR
  • 4. L01A002683    From 1 To 34 E-value: 0.00000000002 Score: 59.7
        CIKNGNGCQPDGSQGNCCSRYCHKEPGWVAGYCR
  • 5. L02A000813    From 1 To 34 E-value: 0.0000000002 Score: 56.2
        CIKNGNGCQPNGSQNGCCSGYCHKQPGWVAGYCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: