Record in detail


General Info

  • lamp_id:L02A001585
  • Name:Pp-AMP1
  • FullName:Pp-AMP1
  • Source:Japanese bamboo shoots, Phyllostachys pubescens
  • Mass:4697.3 Da
  • Sequence Length:44 aa
  • Isoelectric Point:9.54
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        KSCCRSTQARNIYNAPRFAGGSRPLCALGSGCKIVDDKKTPPND
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001585    From 1 To 44 E-value: 4e-21 Score: 92
        KSCCRSTQARNIYNAPRFAGGSRPLCALGSGCKIVDDKKTPPND
  • 2. L06AT00085    From 1 To 42 E-value: 0.0000000002 Score: 56.6
        KSCCPSTTARNVYNSCRFAGGSRNTCAKLSGCKIVDGNCEPP
  • 3. L06AT00084    From 1 To 42 E-value: 0.0000000002 Score: 56.2
        KSCCPSTTARNVYNSCRFAGGSRDTCAKLSGCKIVDGNCKPP
  • 4. L06AT00083    From 1 To 42 E-value: 0.0000000007 Score: 54.3
        KSCCPTTTARNIYNACRFAHGTRERCSKLSGCKIVDGKCKPP
  • 5. L02A000237    From 1 To 39 E-value: 0.0000000009 Score: 53.9
        KSCCPTTTARNIYNTCRFGGGSRPVCAKLSGCKIISGTK

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: