Record in detail


General Info

  • lamp_id:L02A001587
  • Name:Fa-AMP1
  • FullName:Fa-AMP1
  • Source:seeds, buckwheat, Fagopyrum esculentum Moench
  • Mass:3887.4 Da
  • Sequence Length:40 aa
  • Isoelectric Point:7.96
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L02A001587    From 1 To 40 E-value: 2e-16 Score: 76.3
        AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCK
  • 2. L02A001588    From 1 To 40 E-value: 2e-16 Score: 75.9
        AQCGAQGGGATCPGGLCCSQWGWCGSTPKYCGAGCQSNCR
  • 3. L06AT00230    From 1 To 40 E-value: 9e-16 Score: 73.9
        AQCGAQGGGQTCPGGLCCSQWGWCGSTPKYCGAGCQSNCR
  • 4. L06AT00231    From 1 To 42 E-value: 0.0000000005 Score: 54.7
        EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCK
  • 5. L12A10121|    From 2 To 40 E-value: 0.000000003 Score: 52.4
        KCGEQGRGAKCPNCLCCGRYGFCGSTPDYCGVGCQSQCR

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: