Record in detail


General Info

  • lamp_id:L02A001606
  • Name:Sublancin 168
  • FullName:Sublancin 168
  • Source:Bacillus subtilis 168
  • Mass:3720.3 Da
  • Sequence Length:37 aa
  • Isoelectric Point:8.51
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A06744|    From 20 To 56 E-value: 3e-16 Score: 75.5
        GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
  • 2. L02A001606    From 1 To 37 E-value: 0.000000000000001 Score: 73.2
        GLGKAQCAALWLQCASGGTIGCGGGAVACQNYRQFCR
  • 3. L11A011467    From 1 To 37 E-value: 0.0000000006 Score: 54.7
        GLGKAQCAALWLQCASGGTIGXGGGAVACQNYRQFCR
  • 4. L13A012330    From 1 To 18 E-value: 0.00002 Score: 39.3
        IGCGGGAVACQNYRQFCR
  • 5. L13A022502    From 1 To 42 E-value: 1.4 Score: 23.5
        GIGTAQCAYFKALCYSGGSEWLGGYGGCGSTQNNCELARKYC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: