Record in detail


General Info

  • lamp_id:L02A001610
  • Name:Staphylococcin C55
  • FullName:Staphylococcin C55
  • Source:Two-component anti-Staphylococcus aureus lantibiotic activity produced by Staphylococcus aureus C55
  • Mass:3461.8 Da
  • Sequence Length:30 aa
  • Isoelectric Point:7.12
  • Activity:Antibacterial,Antifungal,Antiviral,
  • Sequence
        CSTNTFSLSDYWGNKGNWCTATHECMSWCK
  • Function:

Cross-Linking

Top similar AMPs

  • Top similar AMPs on LAMP
  • 1. L12A08225|    From 33 To 62 E-value: 0.0000000000001 Score: 66.6
        CSTNTFSLSDYWGNKGNWCTATHECMSWCK
  • 2. L02A001610    From 1 To 30 E-value: 0.0000000000008 Score: 64.3
        CSTNTFSLSDYWGNKGNWCTATHECMSWCK
  • 3. L12A08796|    From 30 To 59 E-value: 0.00000000003 Score: 58.9
        CSTNTFSLSDYWGNNGAWCTLTHECMAWCK
  • 4. L02A001194    From 1 To 30 E-value: 0.00000000009 Score: 57.4
        CSTNTFSLSDYWGNNGAWCTLTHECMAWCK
  • 5. L12A08511|    From 33 To 56 E-value: 0.0008 Score: 34.3
        FGLSRLLGNNGRWCTITKECMPSC

Structure

  •   Domains

  •     No domains found on LAMP database
  •   Structures

        No structs found on LAMP database

Activity

  •   Antibacterial Activities

  •     No MICs found on LAMP database

Toxicity

  •   Toxicity

  •     No toxicity records found on LAMP database

Reference

  •   Reference

  •     No references found on LAMP database

Comments

  •   Comments

  •     No comments found on LAMP database



CAPTCHA Image   Reload Image
Enter Code*: